Iright
BRAND / VENDOR: Proteintech

Proteintech, 28597-1-AP, OATL1 Polyclonal antibody

CATALOG NUMBER: 28597-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OATL1 (28597-1-AP) by Proteintech is a Polyclonal antibody targeting OATL1 in WB, ELISA applications with reactivity to human samples 28597-1-AP targets OATL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information OATL1, also known as TBC1D25, is a protein with a TBC domain and functions as a Rab GTPase activating protein. It is involved in the fusion of autophagosomes with endosomes and lysosomes. OATL1 is recruited to isolation membranes and autophagosomes through direct interaction with Atg8 homologues and is involved in the fusion between autophagosomes and lysosomes through its GAP activity. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29470 Product name: Recombinant human TBC1D25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 32-299 aa of BC101817 Sequence: EREVVRVRVKKCESFLPPEFRSFAVDPQITSLDVLQHILIRAFDLSGKKNFGISYLGRDRLGQEVYLSLLSDWDLSTAFATASKPYLQLRVDIRPSEDSPLLEDWDIISPKDVIGSDVLLAEKRSSLTTAALPFTQSILTQVGRTLSKVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPSLRKVVWRYLLNVYPDGLTGRERMDYMKRKSREYEQLKSEWAQRANPEDLEFIRSTVLKDVLRTDRAH Predict reactive species Full Name: TBC1 domain family, member 25 Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC101817 Gene Symbol: TBC1D25 Gene ID (NCBI): 4943 RRID: AB_3669665 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3MII6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924