Iright
BRAND / VENDOR: Proteintech

Proteintech, 29896-1-AP, CD8a Polyclonal antibody

CATALOG NUMBER: 29896-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul CD8a Polyclonal Antibody for WB, IF-Fro, ELISA 29896-1-AP targets CD8a in WB, IF-Fro, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse thymus tissue Positive IF-Fro detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 is composed of two disulfide-linked chains and can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells , on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084). Specification Tested Reactivity: mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31942 Product name: Recombinant mouse CD8A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 28-196 aa of NM_001081110 Sequence: KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY Predict reactive species Full Name: CD8 antigen, alpha chain Calculated Molecular Weight: 27KD Observed Molecular Weight: 32-35 kDa GenBank Accession Number: NM_001081110 Gene Symbol: Cd8a Gene ID (NCBI): 12525 RRID: AB_2935485 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01731 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924