Proteintech, 29954-1-AP, PER2 Polyclonal antibody

Size: 20ul / 150ul The PER2 (29954-1-AP) by Proteintech is a Polyclonal antibody targeting PER2 in WB, IF/ICC, ELISA applications with reactivity to Human samples 29954-1-AP targets PER2 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: BxPC-3 cells, HeLa cells Positive IF/ICC detected in: MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PER2, also named as KIAA0347, is a component of the circadian clock mechanism which is essential for generating circadian rhythms. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) which is characterized by very early sleep onset and offset. There are two isoforms of PER2: isoform 1 has an expected molecular size of about 140 kDa, while isoform 2, known as PER2S (a second splicing variant of the human PER2 gene), has a molecular weight of about 45 kDa (PMID:26347774). 29954-1-AP detected molecular weight of 45 kDa. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31471 Product name: Recombinant human PER2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_022817 Sequence: MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKA Predict reactive species Full Name: period homolog 2 (Drosophila) Calculated Molecular Weight: 137KD Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_022817 Gene Symbol: PER2 Gene ID (NCBI): 8864 RRID: AB_3086198 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15055 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.