Iright
BRAND / VENDOR: Proteintech

Proteintech, 29985-1-AP, MLK2 Polyclonal antibody

CATALOG NUMBER: 29985-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MLK2 (29985-1-AP) by Proteintech is a Polyclonal antibody targeting MLK2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29985-1-AP targets MLK2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MAP3K10, also named as MLK2 and MST, belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family and MAP kinase kinase kinase subfamily. MAP3K10 activates the JUN N-terminal pathway. MAP3K10 catalyzes the reaction: ATP + a protein = ADP + a phosphoprotein. MAP3K10 can be detected 104-115 kDa by phosphorylation (PMID: 23178452). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32419 Product name: Recombinant human MAP3K10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-620 aa of NM_002446 Sequence: LPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHTPIAPGFASLNEMEEFAEAED Predict reactive species Full Name: mitogen-activated protein kinase kinase kinase 10 Calculated Molecular Weight: 104KD Observed Molecular Weight: 104-115 kDa GenBank Accession Number: NM_002446 Gene Symbol: MAP3K10 Gene ID (NCBI): 4294 RRID: AB_3086204 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02779 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924