Iright
BRAND / VENDOR: Proteintech

Proteintech, 30018-1-AP, ZNF643 Polyclonal antibody

CATALOG NUMBER: 30018-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF643 (30018-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF643 in WB, ELISA applications with reactivity to human samples 30018-1-AP targets ZNF643 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HuH-7 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information ZNF643 (Zinc finger protein 643) is also named as ZFP69B. ZNF643, a putative transcription factor gene, is situated next to ZFP69, which has been linked to pathogenesis of human diabetes, as its allelic variation associates with impaired lipid storage in white adipose tissue (PMID: 19578398). It may be involved in transcriptional regulation, and is essential for Golgi structural integrity (PMID:29851555). ZNF643 has two isoforms with molecular weights of 50 kDa and 62 kDa. ZNF643 is modified by SUMO. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32346 Product name: Recombinant human ZNF643 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 48-180 aa of BC017498 Sequence: KTKTKESALQNDISWEELHCGLMMERFTKGSSMYSTLGRISKCNKLESQQENQRMGKGQIPLMCKKTFTQERGQESNRFEKRINVKSEVMPGPIGLPRKRDRKYDTPGKRSRYNIDLVNHSRSYTKMKTFECN Predict reactive species Full Name: zinc finger protein 643 Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC017498 Gene Symbol: ZNF643 Gene ID (NCBI): 65243 RRID: AB_3086212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJL9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924