Iright
BRAND / VENDOR: Proteintech

Proteintech, 30239-1-AP, USP50 Polyclonal antibody

CATALOG NUMBER: 30239-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The USP50 (30239-1-AP) by Proteintech is a Polyclonal antibody targeting USP50 in WB, ELISA applications with reactivity to human, mouse samples 30239-1-AP targets USP50 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information USP50 (Ubiquitin Specific Peptidase 50) is a deubiquitinating enzyme that belongs to the USP family. It plays a key role in DNA replication, genome stability and cell cycle regulation. Recent studies have found that USP50 maintains the stability of the DNA replication process and telomere integrity by regulating the use of nuclease and deconjugating enzymes. During replication, USP50 was able to inhibit the harmful DNA2 nuclease activity and substitute the use of RecQ deconjugase, thereby preventing replication fork stalling and DNA damage. In addition, USP50 plays a role in the cell cycle G2/M phase transition, assembly of the NLRP3 inflammasome complex, and organization of nuclear speckles. Its loss of function leads to DNA double-strand breaks and telomere instability in cells under replication stress. These findings provide new insights into the understanding of the pathogenesis of genetic diseases and may offer potential targets for the treatment of diseases such as cancer and premature aging. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31275 Product name: Recombinant human USP50 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 145-290 aa of BC146493 Sequence: NELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTTKRKLRTDIHY Predict reactive species Full Name: ubiquitin specific peptidase 50 Calculated Molecular Weight: 339 aa, 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC146493 Gene Symbol: USP50 Gene ID (NCBI): 373509 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q70EL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924