Iright
BRAND / VENDOR: Proteintech

Proteintech, 30326-1-AP, PFKM Polyclonal antibody

CATALOG NUMBER: 30326-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PFKM (30326-1-AP) by Proteintech is a Polyclonal antibody targeting PFKM in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30326-1-AP targets PFKM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, HEK-293 cells, Raji cells, MCF-7 cells Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: 48-well HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PFKM, also named as GSD7, PFK-1, PFK-M and PFKX, belongs to the phosphofructokinase family and two domains subfamily. PFKM catalyzes the reaction: ATP + D-fructose 6-phosphate = ADP + D-fructose 1,6-bisphosphate. It is a key regulatory enzyme in glycolysis. Defects in PFKM are the cause of glycogen storage disease type 7 (GSD7). PFKM has three isoforms with molecular masses of 85, 82 and 93 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30840 Product name: Recombinant human PFKM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 675-725 aa of BC021203 Sequence: FATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAE Predict reactive species Full Name: phosphofructokinase, muscle Observed Molecular Weight: 75-85 kDa GenBank Accession Number: BC021203 Gene Symbol: PFKM Gene ID (NCBI): 5213 RRID: AB_3086294 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08237 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924