Iright
BRAND / VENDOR: Proteintech

Proteintech, 30532-1-AP, Aggrecan Polyclonal antibody

CATALOG NUMBER: 30532-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Aggrecan (30532-1-AP) by Proteintech is a Polyclonal antibody targeting Aggrecan in IHC, ELISA applications with reactivity to human samples 30532-1-AP targets Aggrecan in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: ATDC-5 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Aggrecan (ACAN), also named as CSPCP, AGC1 and MSK16, belongs to the aggrecan/versican proteoglycan family (also including versican, brevican and neurocan). It is a major component of extracellular matrix of cartilaginous tissues. A major function of aggrecan is to resist compression in cartilage. It binds avidly to hyaluronic acid via an N-terminal globular region. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32723 Product name: Recombinant human ACAN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC036445 Sequence: MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGI Predict reactive species Full Name: aggrecan Calculated Molecular Weight: 250 kDa GenBank Accession Number: BC036445 Gene Symbol: ACAN Gene ID (NCBI): 176 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16112 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924