Iright
BRAND / VENDOR: Proteintech

Proteintech, 30540-1-AP, NOTCH3 Polyclonal antibody

CATALOG NUMBER: 30540-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NOTCH3 (30540-1-AP) by Proteintech is a Polyclonal antibody targeting NOTCH3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 30540-1-AP targets NOTCH3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Caco-2 cells, HeLa cells, U2OS cells, mouse lung tissue Positive IP detected in: HeLa cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NOTCH3 (Neurogenic locus notch homolog protein 3) is one of four mammalian Notch proteins, which act as signalling receptors to control cell fate in many developmental and adult tissue contexts (PMID: 32210034). Notch is a transmembrane, developmental signalling receptor, which plays many crucial roles in developmental patterning, cell fate decisions, regulation of cell survival and proliferation (PMID:30246579). Genetic studies have shown that Notch3 gene knockouts are viable and have limited developmental defects, focussed mostly on defects in the arterial smooth muscle cell lineage. Notch3, in collaboration with other Notch proteins, is involved in stem cell regulation in different tissues in stem cell regulation in different tissues, and it also controls the plasticity of the vascular smooth muscle phenotype involved in arterial vessel remodelling. Overexpression, gene amplification and mis-activation of Notch3 are associated with different cancers, in particular triple negative breast cancer and ovarian cancer (PMID: 32210034). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30242 Product name: Recombinant human NOTCH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2203-2321 aa of NM_000435 Sequence: SPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAMATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA Predict reactive species Full Name: Notch homolog 3 (Drosophila) Calculated Molecular Weight: 244 kDa Observed Molecular Weight: 270 kDa, 90 kDa GenBank Accession Number: NM_000435 Gene Symbol: NOTCH3 Gene ID (NCBI): 4854 RRID: AB_3086356 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UM47 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924