Iright
BRAND / VENDOR: Proteintech

Proteintech, 30713-1-AP, ADRB3 Polyclonal antibody

CATALOG NUMBER: 30713-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADRB3 (30713-1-AP) by Proteintech is a Polyclonal antibody targeting ADRB3 in WB, ELISA applications with reactivity to Human samples 30713-1-AP targets ADRB3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Beta-3 adrenergic receptor(ADRB3), a member of the G-protein-coupled receptor family, is expressed mainly in adipose tissue and is thought to contribute to lipolysis and thermogenesis. In addition, the overexpression of ADRB3 has been found in several cancer types, including breast cancer, gallbladder cancer , and colorectal cancer. More recently, the involvement of ADRB3 in the metabolic reprogramming of melanoma, the promotion of immune tolerance, and the regulation of cancer differentiation have been described. (PMID: 32514619) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31466 Product name: Recombinant human ADRB3 protein Source: e coli. -derived, pet43.1a Tag: NUS+HIS Domain: 179-292 aa of NM_000025 Sequence: RVGADAEAQRCHSNPRCCAFASNMPYVLLSSSVSFYLPLLVMLFVYARVFVVATRQLRLLRGELGRFPPEESPPAPSRSLAPAPVGTCAPPEGVPACGRRPARLLPLREHRALC Predict reactive species Full Name: adrenergic, beta-3-, receptor Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 44-50 kDa GenBank Accession Number: NM_000025 Gene Symbol: ADRB3 Gene ID (NCBI): 155 RRID: AB_3086396 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13945 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924