Iright
BRAND / VENDOR: Proteintech

Proteintech, 30963-1-AP, AGTR2 Polyclonal antibody

CATALOG NUMBER: 30963-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AGTR2 (30963-1-AP) by Proteintech is a Polyclonal antibody targeting AGTR2 in WB, IF/ICC, ELISA applications with reactivity to human samples 30963-1-AP targets AGTR2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information AGTR2 (angiotensin II type 2 receptor) is part of the renin-angiotensin signaling (RAS) pathway that has been widely studied for its role in blood pressure regulation and renal and cardiovascular health (PMID: 29937318). AGTR2 mediates the effects of angiotensin II on cellular differentiation and growth (PMID: 30455538). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33887 Product name: Recombinant human AGTR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-45 aa of NM_000686 Sequence: MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD Predict reactive species Full Name: angiotensin II receptor, type 2 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: NM_000686 Gene Symbol: AGTR2 Gene ID (NCBI): 186 RRID: AB_3669797 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P50052 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924