Iright
BRAND / VENDOR: Proteintech

Proteintech, 31194-1-AP, ABCA9 Polyclonal antibody

CATALOG NUMBER: 31194-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ABCA9 (31194-1-AP) by Proteintech is a Polyclonal antibody targeting ABCA9 in WB, ELISA applications with reactivity to human samples 31194-1-AP targets ABCA9 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ATP-binding cassette subfamily A member 9 (ABCA9) belongs to the superfamily of ATP-binding cassette (ABC) transporters and contains two transmembrane domains and two nucleotide-binding folds. It has 5 isoforms and may play a role in monocyte differentiation and lipid transport and homeostasis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35032 Product name: Recombinant human ABCA9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-183 aa of BC167781 Sequence: HQVHDTPQMSSMDLGRVDSFNDTNYVIAFAPESKTTQEIMNKVASAPFLKGRTIMGWPDEKSMDELDLNYSIDAVRVIFTDTFSYHLKFSWGHRIPMMKEHRDHSAHCQAVNEKMKCEGSEFWEKGFVAFQA Predict reactive species Full Name: ATP-binding cassette, sub-family A (ABC1), member 9 Observed Molecular Weight: 31 kDa GenBank Accession Number: BC167781 Gene Symbol: ABCA9 Gene ID (NCBI): 10350 RRID: AB_3669893 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IUA7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924