Iright
BRAND / VENDOR: Proteintech

Proteintech, 31203-1-AP, SEMG2 Polyclonal antibody

CATALOG NUMBER: 31203-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SEMG2 (31203-1-AP) by Proteintech is a Polyclonal antibody targeting SEMG2 in IHC, ELISA applications with reactivity to human, mouse samples 31203-1-AP targets SEMG2 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SEMG2 genes belong to the family of cancer-testis antigens (CTAs), whose expression normally is restricted to male germ cells but is often restored in various malignancies. SEMGs were found expressed in various malignancies including prostate, lung, and renal carcinoma, as well as in some blood neoplasms (PMID: 33311447). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35285 Product name: Recombinant human SEMG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 490-582 aa of NM_003008.2 Sequence: SQSSISFQIEKLVEGKSQIQTPNPNQDQWSGQNAKGKSGQSADSKQDLLSHEQKGRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNPIST Predict reactive species Full Name: semenogelin II Calculated Molecular Weight: 65kDa,582aa GenBank Accession Number: NM_003008.2 Gene Symbol: SEMG2 Gene ID (NCBI): 6407 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q02383 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924