Iright
BRAND / VENDOR: Proteintech

Proteintech, 31540-1-AP, LMTK2 Polyclonal antibody

CATALOG NUMBER: 31540-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LMTK2 (31540-1-AP) by Proteintech is a Polyclonal antibody targeting LMTK2 in WB, ELISA applications with reactivity to human, mouse samples 31540-1-AP targets LMTK2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, U2OS cells, BV-2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Lemur tyrosine kinase 2 (LMTK2) is a transmembrane protein with serine and threonine but not tyrosine kinase activity. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35620 Product name: Recombinant human LMTK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1371-1503 aa of BC131504 Sequence: TPTKELGPCGGEACGPDLSGPAPASGSPYLSRCINSESSTDEEGGGFEWDDDFSPDPFMSKTTSNLLSSKPSLQTSKYFSPPPPARSTEQSWPHSAPYSRFSISPANIASFSLTHLTDSDIEQGGSSEDGEKD Predict reactive species Full Name: lemur tyrosine kinase 2 Observed Molecular Weight: 250 kDa GenBank Accession Number: BC131504 Gene Symbol: LMTK2 Gene ID (NCBI): 22853 RRID: AB_3670029 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IWU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924