Iright
BRAND / VENDOR: Proteintech

Proteintech, 31629-1-AP, CRYZ Polyclonal antibody

CATALOG NUMBER: 31629-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRYZ (31629-1-AP) by Proteintech is a Polyclonal antibody targeting CRYZ in WB, ELISA applications with reactivity to human, mouse samples 31629-1-AP targets CRYZ in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CRYZ (Zeta-crystallin) also called quinone oxidoreductase and NADPH:quinone reductase, and it does not have alcohol dehydrogenase activity. It binds NADP and acts through a one-electron transfer process. Orthoquinones, such as 1,2-naphthoquinone or 9,10-phenanthrenequinone, are the best substrates (in vitro) for CRYZ. It may act in the detoxification of xenobiotics. CRYZ interacts with (AU)-rich elements (ARE) in the 3'-UTR of target mRNA species and enhances the stability of mRNA coding for BCL2. NADPH binding interferes with mRNA binding (PMID: 17497241; 20103721). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35066 Product name: Recombinant human CRYZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 143-329 aa of BC039578 Sequence: SACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL Predict reactive species Full Name: crystallin, zeta (quinone reductase) Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC039578 Gene Symbol: CRYZ Gene ID (NCBI): 1429 RRID: AB_3670055 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q08257 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924