Iright
BRAND / VENDOR: Proteintech

Proteintech, 31663-1-AP, CHML Polyclonal antibody

CATALOG NUMBER: 31663-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHML (31663-1-AP) by Proteintech is a Polyclonal antibody targeting CHML in WB, ELISA applications with reactivity to human samples 31663-1-AP targets CHML in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293T cells, NCI-H1299 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35925 Product name: Recombinant human CHML protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-215 aa of NM_001821.3 Sequence: KEYQQNNDIGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRN Predict reactive species Full Name: choroideremia-like (Rab escort protein 2) Calculated Molecular Weight: 74kDa,656aa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: NM_001821.3 Gene Symbol: CHML Gene ID (NCBI): 1122 RRID: AB_3670066 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P26374 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924