Iright
BRAND / VENDOR: Proteintech

Proteintech, 32728-1-AP, KCTD20 Polyclonal antibody

CATALOG NUMBER: 32728-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCTD20 (32728-1-AP) by Proteintech is a Polyclonal antibody targeting KCTD20 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 32728-1-AP targets KCTD20 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36947 Product name: Recombinant human KCTD20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of NM_173562.4 Sequence: MNVHRGSDSDRLLRQEASCLVDDTLAVAQEKEANSLASSGPHNLTYPLGPRNEDLSLDYASQPANLQFPHIMPLAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPD Predict reactive species Full Name: potassium channel tetramerisation domain containing 20 Calculated Molecular Weight: 47kDa,419aa GenBank Accession Number: NM_173562.4 Gene Symbol: KCTD20 Gene ID (NCBI): 222658 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q7Z5Y7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924