Iright
BRAND / VENDOR: Proteintech

Proteintech, 32844-1-AP, RNPS1 Polyclonal antibody

CATALOG NUMBER: 32844-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RNPS1 (32844-1-AP) by Proteintech is a Polyclonal antibody targeting RNPS1 in WB, IP, ELISA applications with reactivity to human samples 32844-1-AP targets RNPS1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Raji cells, Ramos cells, fetal human brain tissue Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The splicing process of mRNA must be highly precise to carry the correct genetic information to the cytoplasm as templates for translation. And this process involves more than 50 proteins in the splicing complex. RNPS1 is a versatile factor that regulates alternative splicing of a number of pre-mRNAs. It participates in both constitutive splicing and in distinctive modulation of alternative splicing in a substrate dependent manner, and involved in UPF2-dependent nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Its ser-53 phosphorylation site is important for splicing and translation stimulation activity in vitro. The molecular weight observed is consistent with what has been described in the literature (PMID: 39687031/PMID: 10449421). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag37888 Product name: Recombinant human RNPS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-239 aa of BC001838 Sequence: PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL Predict reactive species Full Name: RNA binding protein S1, serine-rich domain Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC001838 Gene Symbol: RNPS1 Gene ID (NCBI): 10921 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15287 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924