Iright
BRAND / VENDOR: Proteintech

Proteintech, 33105-1-AP, EPHA6 Polyclonal antibody

CATALOG NUMBER: 33105-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPHA6 (33105-1-AP) by Proteintech is a Polyclonal antibody targeting EPHA6 in WB, ELISA applications with reactivity to mouse, rat samples 33105-1-AP targets EPHA6 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information EPHA6, also named as EHK2, belongs to the protein kinase superfamily, Tyr protein kinase family and Ephrin receptor subfamily. It is a receptor for members of the ephrin-A family. EPHA6 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg2857 Product name: Recombinant Mouse Epha6 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 28-546 aa of N/A Sequence: SHVSNQVVLLDTTTVMGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLYYIESDESHGTKFKPSQYIKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSSTYVEATSVCHCEKGYFRAEKDPPSMACTRPPSAPRNVAFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTTQCEDCGGGLRFIPRHTGLINNSVVVLDFVSHVNYTFEIEAMNGVSELSISPKPFTAITVTTDHDAPSLIGMMRKDWASQNSLALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIVTGLKPATTYIFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQ Predict reactive species Full Name: Eph receptor A6 Calculated Molecular Weight: 116 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: N/A Gene Symbol: Epha6 Gene ID (NCBI): 13840 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q62413 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924