Proteintech, 33363-1-AP, Luteinizing Hormone beta Polyclonal antibody

Size: 20ul / 150ul The Luteinizing Hormone beta (33363-1-AP) by Proteintech is a Polyclonal antibody targeting Luteinizing Hormone beta in WB, ELISA applications with reactivity to human samples 33363-1-AP targets Luteinizing Hormone beta in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Luteinizing Hormone beta subunit (LH-β) is a critical glycoprotein hormone chain that confers functional specificity to the intact LH hormone. While it non-covalently associates with the common alpha subunit (shared with other pituitary hormones like FSH and TSH), the unique beta subunit is responsible for dictating receptor binding specificity. The binding of LH to its receptor in the gonads is primarily mediated by the beta subunit, triggering signaling cascades essential for reproductive physiology. In females, this stimulates ovulation and progesterone production, and in males, it drives testosterone synthesis in Leydig cells. Therefore, the expression and structural integrity of the LH-β gene are indispensable for the regulation of steroidogenesis and gametogenesis, making it a cornerstone of the hypothalamic-pituitary-gonadal axis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38132 Product name: Recombinant human Luteinizing Hormone beta protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-141 aa of NM_000894 Sequence: SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL* Predict reactive species Full Name: luteinizing hormone beta polypeptide Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15-18 kDa GenBank Accession Number: NM_000894 Gene Symbol: LHB Gene ID (NCBI): 3972 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P01229 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.