Proteintech, 33366-1-AP, MED29 Polyclonal antibody

Size: 20ul / 150ul The MED29 (33366-1-AP) by Proteintech is a Polyclonal antibody targeting MED29 in WB, IHC, IP, ELISA applications with reactivity to human samples 33366-1-AP targets MED29 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HT-29 cells Positive IP detected in: HT-29 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Mediator of RNA polymerase II transcription subunit 29 (MED29) is also named as Mediator complex subunit 29 and Intersex-like protein (IXL). MED29 is one of the most highly conserved proteins across species and is widely expressed in humans both during embryonic development and in adult tissues (PMID: 15555573). MED29 was overexpressed in pancreatic cancer and promoted pancreatic cancer cell viability (PMID: 21225629, PMID: 17332321). MED29 facilitated the epithelial-mesenchymal transition process in OSCC, thereby promoting migration and invasion (PMID: 39462350). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag38949 Product name: Recombinant human MED29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_017592.2 Sequence: MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL Predict reactive species Full Name: mediator complex subunit 29 Calculated Molecular Weight: 21kDa，200aa Observed Molecular Weight: 21-25 kDa GenBank Accession Number: NM_017592.2 Gene Symbol: MED29 Gene ID (NCBI): 55588 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NX70 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.