Iright
BRAND / VENDOR: Proteintech

Proteintech, 33621-1-AP, CRYBA4 Polyclonal antibody

CATALOG NUMBER: 33621-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRYBA4 (33621-1-AP) by Proteintech is a Polyclonal antibody targeting CRYBA4 in WB, ELISA applications with reactivity to human, mouse, rat samples 33621-1-AP targets CRYBA4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat eye tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Background Information CRYBA4, also called βA4-crystallin, is the dominant structural components of the vertebrate eye lens (PMID: 16960806). Missense mutations of CRYBA4 (e.g., p.R95W, p.V150D) predicted to be highly pathogenic are linked with autosomal-dominant congenital cataract, indicating that both crystallin aggregation and non-lens signaling functions merit therapeutic targeting (PMID: 31935276). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39089 Product name: Recombinant human CRYBA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC069404 Sequence: MTLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETVRSLKVLSGAWVGFEHAGFQGQQYILERGEYPSWDAWGGNTAYPAERLTSFRPAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVGSFHVHSGAWV Predict reactive species Full Name: crystallin, beta A4 Calculated Molecular Weight: 196 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC069404 Gene Symbol: CRYBA4 Gene ID (NCBI): 1413 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P53673 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924