Iright
BRAND / VENDOR: Proteintech

Proteintech, 33792-1-AP, IFNAR2 Polyclonal antibody

CATALOG NUMBER: 33792-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IFNAR2 (33792-1-AP) by Proteintech is a Polyclonal antibody targeting IFNAR2 in WB, ELISA applications with reactivity to human, mouse, rat samples 33792-1-AP targets IFNAR2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Interferon alpha/beta receptor 2 (IFNAR2) is a type I membrane protein that associates with IFNAR1 to form the receptor for type I interferons. Binding and activation of the receptor stimulate Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2, and then increase transcription of the IFN-induced genes whose products exert antiviral, immunomodulatory, and antiproliferative effects. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg6269 Product name: Recombinant mouse Interferon alpha/beta receptor 2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-242 aa of NM_010509 Sequence: SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA Predict reactive species Full Name: interferon (alpha and beta) receptor 2 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 100-105 kDa GenBank Accession Number: NM_010509 Gene Symbol: Ifnar2 Gene ID (NCBI): 15976 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O35664-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924