Iright
BRAND / VENDOR: Proteintech

Proteintech, 33826-1-AP, EOMES/TBR2 Polyclonal antibody

CATALOG NUMBER: 33826-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EOMES/TBR2 (33826-1-AP) by Proteintech is a Polyclonal antibody targeting EOMES/TBR2 in WB, FC (Intra), ELISA applications with reactivity to human samples 33826-1-AP targets EOMES/TBR2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NK-92 cells Positive FC (Intra) detected in: NK-92 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.5 ug per 10^6 cells in a 100 µl suspension Background Information EOMES/TRB2 (also named Eomesodermin/Tbr2) encodes T-box transcription factor expressed highly in the intermediate progenitor stage of the developing neuron. During migration of the neurons, radial glia divide and migrate towards the surface of the cerebral cortex, there are three stages of cellular development: radial glia, intermediate progenitors, and postmitotic projection neurons. Radial glia express Pax6, while intermediate progenitor cells express Eomesodermin/Tbr2, and postmitotic projection neurons express Tbr1 (PMID:15634788; PMID:16320258). This process also called neurogenesis, and demonstrated that Eomesodermin/Tbr2 has been implicated in neurodevelopment. According to the mouse model, several articles showed that EOMES/TRB2 KO mice having proliferating cells decreased and having smaller upper cortical layers and a smaller subventricular zone in the brain (PMID:18940588). What's more, Eomesodermin/Tbr2 has also been found participating in immune response (PMID:20713880). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag39989 Product name: Recombinant human EOMES protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 460-613 aa of NM_005442.3 Sequence: SSHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEE Predict reactive species Full Name: eomesodermin homolog (Xenopus laevis) Calculated Molecular Weight: 686aa, 73 kDa Observed Molecular Weight: 70-72 kDa GenBank Accession Number: NM_005442.3 Gene Symbol: EOMES Gene ID (NCBI): 8320 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O95936 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924