Iright
BRAND / VENDOR: Proteintech

Proteintech, 33854-1-AP, SSBP3 Polyclonal antibody

CATALOG NUMBER: 33854-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SSBP3 (33854-1-AP) by Proteintech is a Polyclonal antibody targeting SSBP3 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 33854-1-AP targets SSBP3 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse thymus tissue, rat spleen tissue, rat thymus tissue, pig thymus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SSBP 3 (single-stranded DNA binding protein 3) is a kind of nuclear transcription co-activator. Its core function is to regulate embryonic development, islet β cell function and gene expression by binding single-stranded DNA and participating in transcription regulation complex. Its abnormality is related to diseases such as metabolism and tumor. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag40791 Product name: Recombinant human SSBP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 335-388 aa of BC066365 Sequence: LGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV Predict reactive species Full Name: single stranded DNA binding protein 3 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC066365 Gene Symbol: SSBP3 Gene ID (NCBI): 23648 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BWW4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924