Iright
BRAND / VENDOR: Proteintech

Proteintech, 60240-1-Ig, AMACR/p504S Monoclonal antibody

CATALOG NUMBER: 60240-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AMACR/p504S (60240-1-Ig) by Proteintech is a Monoclonal antibody targeting AMACR/p504S in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 60240-1-Ig targets AMACR/p504S in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, PC-3 cells, HEK-293 cells, HeLa cells, LNCaP cells, HSC-T6 cells, 4T1 cells, NIH/3T3 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AMACR(Alpha-methyl acyl-CoA racemase) belongs to the CaiB/BaiF CoA-transferase family. It is a mitochondrial and peroxisomal enzyme that catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has 3 isoforms produced by alternative splicing. Defects in AMACR are the cause of alpha-methyl acyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8720 Product name: Recombinant human p504S,AMACR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC009471 Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNS Predict reactive species Full Name: alpha-methylacyl-CoA racemase Calculated Molecular Weight: 382 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC009471 Gene Symbol: AMACR Gene ID (NCBI): 23600 RRID: AB_2881363 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UHK6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924