Proteintech, 60333-1-Ig, TMEM106B (1-46aa) Monoclonal antibody

Size: 20ul / 150ul The TMEM106B (1-46aa) (60333-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM106B (1-46aa) in WB, IP, ELISA applications with reactivity to human samples 60333-1-Ig targets TMEM106B (1-46aa) in WB, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, HeLa cells, K-562 cells, LNCaP cells, A549 cells, Jurkat cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TMEM106B is a genetic risk factor for frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP). Amyotrophic lateral sclerosis (ALS), like FTLD-TDP, is characterized by pathological TDP-43 inclusions. TMEM106B expression in the brain may be linked to mechanisms of disease in FTLD-TDP and risk alleles confer genetic susceptibility by increasing gene expression. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21448 Product name: Recombinant human TMEM106B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-46 aa of BC033901 Sequence: MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVS Predict reactive species Full Name: transmembrane protein 106B Calculated Molecular Weight: 31 kDa Observed Molecular Weight: ~40 kDa GenBank Accession Number: BC033901 Gene Symbol: TMEM106B Gene ID (NCBI): 54664 RRID: AB_2881442 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NUM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.