Iright
BRAND / VENDOR: Proteintech

Proteintech, 66197-1-Ig, IDH1 Monoclonal antibody

CATALOG NUMBER: 66197-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IDH1 (66197-1-Ig) by Proteintech is a Monoclonal antibody targeting IDH1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66197-1-Ig targets IDH1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, DU 145 cells, MCF-7 cells Positive IHC detected in: human liver cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. It can form a homodimer(PMID:15173171).IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ). Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19293 Product name: Recombinant human IDH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 119-414 aa of BC012846 Sequence: RLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL Predict reactive species Full Name: isocitrate dehydrogenase 1 (NADP+), soluble Calculated Molecular Weight: 414 aa, 47 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC012846 Gene Symbol: IDH1 Gene ID (NCBI): 3417 RRID: AB_2881590 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75874 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924