Iright
BRAND / VENDOR: Proteintech

Proteintech, 66208-1-Ig, p120 Catenin Monoclonal antibody

CATALOG NUMBER: 66208-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The p120 Catenin (66208-1-Ig) by Proteintech is a Monoclonal antibody targeting p120 Catenin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66208-1-Ig targets p120 Catenin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, HeLa cells, HEK-293 cells, A549 cells, mouse brain tissue, A431 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissue, human colon cancer tissue, mouse colon tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, HeLa cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Catenins were discovered as proteins that are linked to the cytoplasmic domain of transmembrane cadherins (PMID: 9653641). p120 catenin, also called p120 ctn or catenin delta-1, regulates cell-cell adhesion through its interaction with the cytoplasmic tail of classical and type II cadherins. p120 catenin is a tyrosine kinase substrate implicated in cell transformation by SRC, as well as in ligand-induced receptor signaling through the EGF receptor, the PDGF receptor, and the CSF1 receptor. Different expression patterns of p120 catenin in lobular and ductal carcinomas of breast have been reported: membrane stain for ductal carcinoma and cytoplasmic stain for lobular carcinoma (PMID: 24966968). Different isoforms of p120 catenin are variably expressed in different tissues as a result of alternative splicing and the use of multiple translation initiation codons (PMID: 19150613). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2824 Product name: Recombinant human CTNND1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 546-830 aa of BC010501 Sequence: GYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPLKGTTPLMQKI Predict reactive species Full Name: catenin (cadherin-associated protein), delta 1 Calculated Molecular Weight: 948 aa, 105 kDa Observed Molecular Weight: 90-120 kDa GenBank Accession Number: BC010501 Gene Symbol: p120 Catenin Gene ID (NCBI): 1500 RRID: AB_2881599 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60716 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924