Iright
BRAND / VENDOR: Proteintech

Proteintech, 66268-1-Ig, C1qC Monoclonal antibody

CATALOG NUMBER: 66268-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C1qC (66268-1-Ig) by Proteintech is a Monoclonal antibody targeting C1qC in WB, IF/ICC, ELISA applications with reactivity to human samples 66268-1-Ig targets C1qC in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue Positive IF/ICC detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qC which is the C-chain polypeptide of human complement subcomponent C1q. Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10233 Product name: Recombinant human C1QC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 27-245 aa of BC009016 Sequence: QANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD Predict reactive species Full Name: complement component 1, q subcomponent, C chain Calculated Molecular Weight: 245 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC009016 Gene Symbol: C1QC Gene ID (NCBI): 714 RRID: AB_2881653 Conjugate: Unconjugated Form: Liquid Purification Method: Thiophilic affinity chromatograph UNIPROT ID: P02747 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924