Proteintech, 66331-1-Ig, GP73/GOLPH2 Monoclonal antibody

Size: 20ul / 150ul The GP73/GOLPH2 (66331-1-Ig) by Proteintech is a Monoclonal antibody targeting GP73/GOLPH2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66331-1-Ig targets GP73/GOLPH2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HeLa cells, HEK-293 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Golgi phosphoprotein 2 (GOLPH2, also known as GP73 or GOLM1) is a resident Golgi type-II membrane protein. It is predominantly expressed in the epithelial cells of many human tissues. GOLPH2 traffics through endosomes and can be secreted into the circulation. Its expression is upregulated in a number of tumors and GOLPH2 could be a promising serum marker for hepatocellular carcinoma. We got 73 kDa in western blotting due to phosphorylation. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7207 Product name: Recombinant human GOLM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-400 aa of BC001740 Sequence: SRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL Predict reactive species Full Name: golgi membrane protein 1 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC001740 Gene Symbol: GP73 Gene ID (NCBI): 51280 RRID: AB_2881712 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8NBJ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.