Iright
BRAND / VENDOR: Proteintech

Proteintech, 66441-1-Ig, RGS4 Monoclonal antibody

CATALOG NUMBER: 66441-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RGS4 (66441-1-Ig) by Proteintech is a Monoclonal antibody targeting RGS4 in WB, ELISA applications with reactivity to human, rat, mouse, pig samples 66441-1-Ig targets RGS4 in WB, IHC, ELISA applications and shows reactivity with human, rat, mouse, pig samples. Tested Applications Positive WB detected in: Neuro-2a cells, C6 cells, Raji cells, SH-SY5Y cells, U-251 cells, Y79 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information Regulator of G protein signaling (RGS) proteins are a large family of highly diverse, multifunctional signaling proteins. RGS4 is one of seven members of a classic R4 RGS protein that accelerates the GTPase activity of the Gai/o and Gaq/11 family members. RGS4 is highly expressed in multiple brain regions including the cerebral cortex, amygdala, hippocampus, and striatum. Extensive studies have demonstrated that RGS4 plays an important role in regulating smooth muscle contraction, cardiomyocyte development, neural plasticity and psychiatric disorders. Specification Tested Reactivity: human, rat, mouse, pig Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6029 Product name: Recombinant human RGS4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC051869 Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA Predict reactive species Full Name: regulator of G-protein signaling 4 Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC051869 Gene Symbol: RGS4 Gene ID (NCBI): 5999 RRID: AB_2881811 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49798 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924