Iright
BRAND / VENDOR: Proteintech

Proteintech, 66582-1-Ig, CD100 Monoclonal antibody

CATALOG NUMBER: 66582-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD100 (66582-1-Ig) by Proteintech is a Monoclonal antibody targeting CD100 in WB, IHC, ELISA applications with reactivity to human samples 66582-1-Ig targets CD100 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, K-562 cells, THP-1 cells Positive IHC detected in: human tonsillitis tissue, human kidney tissue, human lymphoma tissue, human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:225-1:900 Background Information CD100 (also known as SEMA4D), a 150 kDa homodimer, belongs to the family of immune semaphorins, and CD100 is abundantly expressed on resting T cells, NK cells, and antigen-presenting cells. As a transmembrane glycoprotein, it is digested to its soluble form, sCD100, by specific matrix metalloproteinases. CD100 has been reported that the expression levels of CD100, and one of its receptors, plexin-B1 (PLXNB1), are increased in head and neck, prostate, colon, breast, and lung cancers, and the interaction between them provides oncogenic signaling essential for tumor growth and metastasis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26461 Product name: Recombinant human CD100 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 756-862 aa of BC054500 Sequence: YKGYLPRQCLKFRSALLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD Predict reactive species Full Name: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D Calculated Molecular Weight: 96 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC054500 Gene Symbol: SEMA4D/CD100 Gene ID (NCBI): 10507 RRID: AB_2881942 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q92854 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924