Iright
BRAND / VENDOR: Proteintech

Proteintech, 66605-1-Ig, ERMN Monoclonal antibody

CATALOG NUMBER: 66605-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ERMN (66605-1-Ig) by Proteintech is a Monoclonal antibody targeting ERMN in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 66605-1-Ig targets ERMN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, pig cerebellum tissue, rat brain tissue, rat cerebellum tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information ERMN is associated with cytoskeletal rearrangements and the stability of myelin sheath. A study has shown that ERMN is expressed specifically in oligodendrocytes in the central nervous system (CNS), and is involved in the formation of myelin (PMID: 20934411). The predicted MW of ERMN is 33 KDa, while western blot analyses of different tissue lysates using 66605-1-Ig antibody to ERMN detected a 50 kDa single band protein as a result of phosphorylation modification. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27040 Product name: Recombinant human ERMN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-257 aa of BC026345 Sequence: MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSR Predict reactive species Full Name: ermin, ERM-like protein Observed Molecular Weight: 50 kDa GenBank Accession Number: BC026345 Gene Symbol: ERMN Gene ID (NCBI): 57471 RRID: AB_2881965 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TAM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924