Iright
BRAND / VENDOR: Proteintech

Proteintech, 66826-1-Ig, PPARA Monoclonal antibody

CATALOG NUMBER: 66826-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPARA (66826-1-Ig) by Proteintech is a Monoclonal antibody targeting PPARA in WB, ELISA applications with reactivity to Human, rat samples 66826-1-Ig targets PPARA in WB, IHC, IF, CoIP, ChIP, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, ROS1728 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Peroxisome proliferator-activated receptor alpha (PPARA) is a ligand-activated transcription factor that belongs to the PPAR nuclear receptor superfamily. PPARA is essential in the modulation of lipid transport and metabolism, mainly through activating mitochondrial and peroxisomal fatty acid β-oxidation pathways. In addition, PPARA seems to decrease inflammation mainly through direct interaction with NF-κB, causing inhibition of its signaling pathway or reducing the activated levels of NF-κB and subsequent inflammation. Furthermore, PPARA was implicated in the attenuation of oxidative stress in alcoholic liver disease when treated with polyenephosphatidylcholine through downregulation of ROS-generating enzymes such as ethanol-inducible cytochrome P450 2E1 (CYP2E1), acyl-CoA oxidase, and NADPH oxidase. PPARA exists two isoforms and molecular weight of PPARA isoforms are 52 kDa and 22 kDa. The ability of a retinoid X receptor (RXR) to heterodimerize with many nuclear receptors, including LXR, PPAR, NGF1B and RAR, underscores its pivotal role within the nuclear receptor superfamily. Among these heterodimers, PPAR:RXR is considered an important signalling mediator of both PPAR ligands, such as fatty acids, and 9-cis retinoic acid (9-cis RA), an RXR ligand. (PMID: 15103326 ). PPARA can form Heterodimer with RXRA and molecular weight of Heterodimer is about 110 kDa. Specification Tested Reactivity: Human, rat Cited Reactivity: human, mouse, rat, pig, chicken, zebrafish, hamster, goat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7896 Product name: Recombinant human PPARA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC000052 Sequence: MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVVEDD Predict reactive species Full Name: peroxisome proliferator-activated receptor alpha Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC000052 Gene Symbol: PPARA Gene ID (NCBI): 5465 RRID: AB_2882169 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q07869 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924