Iright
BRAND / VENDOR: Proteintech

Proteintech, 66915-1-Ig, CX3CR1 Monoclonal antibody

CATALOG NUMBER: 66915-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CX3CR1 (66915-1-Ig) by Proteintech is a Monoclonal antibody targeting CX3CR1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 66915-1-Ig targets CX3CR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, SH-SY5Y cells, U-937 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CX3CR1, also known as GPR13, V28, and fractalkine receptor, belongs to the 7-transmembrane G protein-coupled receptor (GPCR) family. It is expressed in microglia, astrocytes, NK cells, monocytes/macrophages, and a subpopulation of T cells. CX3CR1 is the receptor for fractalkine (CX3CL1) and mediates both its adhesive and migratory functions. It also acts as a coreceptor with CD4 for HIV-1 virus envelope protein (in vitro), and some variations in the gene of CX3CR1 lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Defects in CX3CR1 are a cause of susceptibility to age-related macular degeneration type 12 (ARMD12). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27698 Product name: Recombinant human CX3CR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 56-231 aa of BC028078 Sequence: LTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIK Predict reactive species Full Name: chemokine (C-X3-C motif) receptor 1 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC028078 Gene Symbol: CX3CR1 Gene ID (NCBI): 1524 RRID: AB_2882242 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49238 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924