Iright
BRAND / VENDOR: Proteintech

Proteintech, 67391-1-Ig, FGL1 Monoclonal antibody

CATALOG NUMBER: 67391-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FGL1 (67391-1-Ig) by Proteintech is a Monoclonal antibody targeting FGL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, pig samples 67391-1-Ig targets FGL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, pig samples. Tested Applications Positive WB detected in: pig liver tissue, human placenta tissue Positive IHC detected in: human liver tissue, human lung tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5400 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Fibrinogen-like 1 (FGL1), also termed hepatocyte-derived fibrinogen-related protein 1 (HFREP1) or hepassocin, is a predominantly liver expressed protein that has been implicated as both a hepatoprotectant and a hepatocyte mitogen. FGL1 expression is decreased in hepatocellular carcinoma (HCC), and it may play a role in the development of hepatocellular carcinomas. Specification Tested Reactivity: Human, pig Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8581 Product name: Recombinant human FGL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-312 aa of BC007047 Sequence: MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI Predict reactive species Full Name: fibrinogen-like 1 Calculated Molecular Weight: 312 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC007047 Gene Symbol: FGL1 Gene ID (NCBI): 2267 RRID: AB_2882635 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q08830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924