Iright
BRAND / VENDOR: Proteintech

Proteintech, 67469-1-Ig, SF3B3 Monoclonal antibody

CATALOG NUMBER: 67469-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SF3B3 (67469-1-Ig) by Proteintech is a Monoclonal antibody targeting SF3B3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 67469-1-Ig targets SF3B3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells Positive IHC detected in: human breast cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Introns are removed from nuclear pre-mRNA in 2-step transesterification reactions. Splicing occured in a large ribonucleoprotein particle, called the spliceosome. Spliceosomal intermediate complexes form on pre-mRNA in the order E, A, B, and C, with the catalytic reactions occurring in complex C. U2 small nuclear ribonucleoproteins are one of the proteins essential for spliceosome assembly and mRNA splicing. Functional U2 snRNP is composed of a 12S unit and 2 splicing factors, SF3A, which is composed of 3 proteins, and SF3B, which conposed of 4 proteins. SF3B3 is one of SF3B, and it's required for 'A' complex assembly formed by the stable binding of U2 snRNP to the brachpoint sequence(BPS) in pre-mRNA. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6315 Product name: Recombinant human SF3B3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 250-399 aa of BC003146 Sequence: EDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF Predict reactive species Full Name: splicing factor 3b, subunit 3, 130kDa Calculated Molecular Weight: 136 kDa Observed Molecular Weight: 130-135 kDa GenBank Accession Number: BC003146 Gene Symbol: SF3B3 Gene ID (NCBI): 23450 RRID: AB_2882698 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15393 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924