Iright
BRAND / VENDOR: Proteintech

Proteintech, 67583-1-Ig, HINT1 Monoclonal antibody

CATALOG NUMBER: 67583-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HINT1 (67583-1-Ig) by Proteintech is a Monoclonal antibody targeting HINT1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67583-1-Ig targets HINT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HINT1(Histidine triad nucleotide-binding protein 1) is also named as HINT, PKCI1, PRKCNH1,which is a member of the histidine triad (HIT) family, highly conserved in diverse species and ubiquitously expressed in mammalian tissues.It hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16662 Product name: Recombinant human HINT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-126 aa of BC007090 Sequence: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG Predict reactive species Full Name: histidine triad nucleotide binding protein 1 Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC007090 Gene Symbol: HINT1 Gene ID (NCBI): 3094 RRID: AB_2882793 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49773 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924