Iright
BRAND / VENDOR: Proteintech

Proteintech, 67712-1-Ig, EPRS Monoclonal antibody

CATALOG NUMBER: 67712-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPRS (67712-1-Ig) by Proteintech is a Monoclonal antibody targeting EPRS in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 67712-1-Ig targets EPRS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, PC-12 cells, HEK-293 cells, HepG2 cells, LNCaP cells, Jurkat cells Positive IP detected in: HeLa cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, BV-2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Human EPRS is a 172 kDa, 1512 amino acid polypeptide consisting of three major domains. The N and C termini contain ERS and PRS catalytic domains, respectively, joined by a 300 amino acid linker containing three tandem WHEP-TRS (referred to as WHEP) domains. EPRS is a bifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. EPRS has a special role in GAIT-mediated translational control, as it is solely responsible for recognition and interaction with GAIT elements in target mRNAs. (PMID: 29576217, PMID: 22386318, PMID: 19647514) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19184 Product name: Recombinant human EPRS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1163-1512 aa of BC126275 Sequence: RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY Predict reactive species Full Name: glutamyl-prolyl-tRNA synthetase Calculated Molecular Weight: 1512 aa, 171 kDa Observed Molecular Weight: 171 kDa GenBank Accession Number: BC126275 Gene Symbol: EPRS Gene ID (NCBI): 2058 RRID: AB_2882902 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P07814 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924