Iright
BRAND / VENDOR: Proteintech

Proteintech, 67789-1-Ig, CD73 Monoclonal antibody

CATALOG NUMBER: 67789-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD73 (67789-1-Ig) by Proteintech is a Monoclonal antibody targeting CD73 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 67789-1-Ig targets CD73 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, A549 cells, HT-29 cells, U-87 MG cells Positive IHC detected in: human tonsillitis tissue, mouse kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human appendicitis tissue, human tonsillitis tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Background Information CD73, also known as ecto-5'-nucleotidase (5'-NT), is a 70-kDa, glycosyl-phosphatidylinositol-linked membrane-bound glycoprotein found in most tissues (PMID: 18404475; 20179192). CD73 is an ectoenzyme that catalyzes the dephosphorylation of AMP and other nucleoside monophosphates (PMID: 9553767). In the human immune system, CD73 is expressed on subsets of T and B cells, on germinal center follicular dendritic cells, and on thymic medullary reticular fibroblasts and epithelial cells (PMID: 2137649; 9553767). CD73 is highly expressed in many human solid tumors and is closely involved in cancer progression (PMID: 20179192). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30616 Product name: Recombinant human NT5E,CD73 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 32-264 aa of BC015940 Sequence: LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR Predict reactive species Full Name: 5'-nucleotidase, ecto (CD73) Calculated Molecular Weight: 29 kDa, 63 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC015940 Gene Symbol: CD73 Gene ID (NCBI): 4907 RRID: AB_2918553 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P21589 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924