Iright
BRAND / VENDOR: Proteintech

Proteintech, 67837-1-Ig, RAB1B Monoclonal antibody

CATALOG NUMBER: 67837-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAB1B (67837-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB1B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67837-1-Ig targets RAB1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, NIH/3T3 cells, HeLa cells, U2OS cells, LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells Positive IHC detected in: human lung cancer tissue, human liver cancer tissue, human ovary tumor tissue, human pancreas cancer tissue, human stomach cancer tissue, rat brain tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12069 Product name: Recombinant human RAB1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC071169 Sequence: MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC Predict reactive species Full Name: RAB1B, member RAS oncogene family Calculated Molecular Weight: 201 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC071169 Gene Symbol: RAB1B Gene ID (NCBI): 81876 RRID: AB_2918599 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9H0U4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924