Iright
BRAND / VENDOR: Proteintech

Proteintech, 68250-1-Ig, Podocalyxin Monoclonal antibody

CATALOG NUMBER: 68250-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Podocalyxin (68250-1-Ig) by Proteintech is a Monoclonal antibody targeting Podocalyxin in IHC, IF-P, ELISA applications with reactivity to human samples 68250-1-Ig targets Podocalyxin in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human kidney tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Podocalyxin, also known as podocalyxin-like protein 1 (PODXL or PCLP1), is a transmembrane glycoprotein belonging to the CD34 family of sialomucins. Podocalyxin was originally identified as the major sialoprotein on podocytes of the kidney glomerulus, but was later found to be expressed on vascular endothelial cells and early hematopoietic progenitors. It Involved in the regulation of both adhesion and cell morphology. In addition, podocalyxin is highly expressed in embryonic stem cells and aberrant expression of podocalyxin has been implicated in a wide range of cancers. Podocalyxin is a protein with a peptide bone of ∼55.5 kDa that undergoes a post‐translational glycosylation, the different molecular mass of podocalyxin indicates the extent and variability of glycosylation patterns (PMID: 17092254). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12859 Product name: Recombinant human TRA-1-60 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-428 aa of BC093730 Sequence: SPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSM Predict reactive species Full Name: podocalyxin-like Calculated Molecular Weight: 526 aa, 55 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC093730 Gene Symbol: Podocalyxin Gene ID (NCBI): 5420 RRID: AB_2935335 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00592 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924