Iright
BRAND / VENDOR: Proteintech

Proteintech, 68476-1-Ig, LPCAT2 Monoclonal antibody

CATALOG NUMBER: 68476-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LPCAT2 (68476-1-Ig) by Proteintech is a Monoclonal antibody targeting LPCAT2 in WB, ELISA applications with reactivity to Human, mouse, rat samples 68476-1-Ig targets LPCAT2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells, A375 cells, A549 cells, HEK-293 cells, HT-29 cells, Jurkat cells, HL-60 cells, HSC-T6 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information LPCAT2 (Lysophosphatidylcholine acyltransferase 2) is also named as AGPAT11 and AYTL1. Lipid droplet (LD) content of CRC cells positively correlates with the expression of lysophosphatidylcholine acyltransferase 2 (LPCAT2), an LD-localised enzyme supporting phosphatidylcholine synthesis (PMID: 29358673). Mitochondria play a significant role in ACSL4/LPCAT2-driven ferroptosis (PMID: 3762584). In response to LPS, LPCAT2, but not LPCAT1, rapidly associates with TLR4 and translocates to membrane lipid raft domains to regulate macrophage inflammatory gene expression (PMID: 32587324). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26420 Product name: Recombinant human LPCAT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 340-544 aa of BC002472 Sequence: EAGLVEFTKISRKLKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSDKKDD Predict reactive species Full Name: lysophosphatidylcholine acyltransferase 2 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC002472 Gene Symbol: LPCAT2 Gene ID (NCBI): 54947 RRID: AB_3085187 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q7L5N7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924