Iright
BRAND / VENDOR: Proteintech

Proteintech, 68556-1-Ig, MRPL24 Monoclonal antibody

CATALOG NUMBER: 68556-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRPL24 (68556-1-Ig) by Proteintech is a Monoclonal antibody targeting MRPL24 in WB, ELISA applications with reactivity to human samples 68556-1-Ig targets MRPL24 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, A431 cells, HT-29 cells, LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9576 Product name: Recombinant human MRPL24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-216 aa of BC016700 Sequence: MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYWY Predict reactive species Full Name: mitochondrial ribosomal protein L24 Calculated Molecular Weight: 216 aa, 25 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC016700 Gene Symbol: MRPL24 Gene ID (NCBI): 79590 RRID: AB_3085259 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96A35 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924