Iright
BRAND / VENDOR: Proteintech

Proteintech, 68928-1-Ig, SAT1 Monoclonal antibody

CATALOG NUMBER: 68928-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SAT1 (68928-1-Ig) by Proteintech is a Monoclonal antibody targeting SAT1 in WB, ELISA applications with reactivity to human samples 68928-1-Ig targets SAT1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33644 Product name: Recombinant human SAT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-171 aa of BC008424 Sequence: MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE Predict reactive species Full Name: spermidine/spermine N1-acetyltransferase 1 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 15-25 kDa GenBank Accession Number: BC008424 Gene Symbol: SAT1 Gene ID (NCBI): 6303 RRID: AB_3670455 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21673 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924