Iright
BRAND / VENDOR: Proteintech

Proteintech, 82788-1-RR, RACGAP1 Recombinant monoclonal antibody

CATALOG NUMBER: 82788-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RACGAP1 (82788-1-RR) by Proteintech is a Recombinant antibody targeting RACGAP1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 82788-1-RR targets RACGAP1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, U2OS cells, K-562 cells, Jurkat cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Rac GTPase-activating protein 1 (RACGAP1), localized in the mitotic spindle, has guanosine triphosphatase-activating protein (GAP) activity for the Rho family GTPases. RACGAP1 has an important influence on the initiation of cytokinesis, control of cell growth and differentiation, regulation of spermatogenesis, and tumor metastasis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4676 Product name: Recombinant human RACGAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 334-632 aa of BC032754 Sequence: PCIPTLIGTPVKIGEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK Predict reactive species Full Name: Rac GTPase activating protein 1 Calculated Molecular Weight: 632 aa, 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC032754 Gene Symbol: RACGAP1 Gene ID (NCBI): 29127 RRID: AB_3670551 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H0H5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924