Iright
BRAND / VENDOR: Proteintech

Proteintech, 82971-1-RR, GARNL1 Recombinant monoclonal antibody

CATALOG NUMBER: 82971-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GARNL1 (82971-1-RR) by Proteintech is a Recombinant antibody targeting GARNL1 in WB, FC (Intra), ELISA applications with reactivity to human samples 82971-1-RR targets GARNL1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GARNL1/RalGAPα1, a major α subunit of the Ral-GTPase activating protein in skeletal muscle, is a protein whose phosphorylation and binding to the regulatory 14-3-3 proteins is stimulated by insulin and also by muscle contraction (PMID:24768767). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31518 Product name: Recombinant human GARNL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 680-820 aa of NM_014990.3 Sequence: LDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRSTRVRHFSQSEETGNEVFGALNEEQPLPRSSSTSDILEPFTVERAKVNKEDMSQK Predict reactive species Full Name: GTPase activating Rap/RanGAP domain-like 1 Calculated Molecular Weight: 230KD Observed Molecular Weight: 260 kDa GenBank Accession Number: NM_014990.3 Gene Symbol: GARNL1 Gene ID (NCBI): 253959 RRID: AB_3670719 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6GYQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924