Iright
BRAND / VENDOR: Proteintech

Proteintech, 83038-4-RR, ABCD1 Recombinant monoclonal antibody

CATALOG NUMBER: 83038-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ABCD1 (83038-4-RR) by Proteintech is a Recombinant antibody targeting ABCD1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83038-4-RR targets ABCD1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, JAR cells, mouse liver tissue Positive IF/ICC detected in: HeLa cells, HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ABCD1 (also known as ALDP) is a member of the ATP-binding cassette (ABC) transporter superfamily which functions as transporter for a wide variety of substrates. It localizes to the peroxisomal membrane. The exact function is not clear so far. Various mutations of ABCD1 cause X-linked adrenoleukodystrophy (X-ALD), an inherited neurodegenerative disease affecting the nervous system white matter and adrenal cortex. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0453 Product name: Recombinant human ABCD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 334-507 aa of BC025358 Sequence: LMKYVWSASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEGMHLLITG Predict reactive species Full Name: ATP-binding cassette, sub-family D (ALD), member 1 Calculated Molecular Weight: 745 aa, 83 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC025358 Gene Symbol: ABCD1 Gene ID (NCBI): 215 RRID: AB_3670769 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P33897 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924