Iright
BRAND / VENDOR: Proteintech

Proteintech, 83199-2-RR, MIF Recombinant monoclonal antibody

CATALOG NUMBER: 83199-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MIF (83199-2-RR) by Proteintech is a Recombinant antibody targeting MIF in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83199-2-RR targets MIF in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, THP-1 cells, RAW 264.7 cells, Neuro-2a cells, mouse brain tissue, rat brain tissue Positive FC (Intra) detected in: Neuro-2a cells, RAW 264.7 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Macrophage migration inhibitory factor (MIF) is a homo-trimeric protein that acts as a pleiotropic pro-inflammatory cytokine. It is involved in various functions, including leukocyte recruitment, inflammation, immune responses, cell proliferation, tumorigenesis, and counter-regulation of glucocorticoids (GC). MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0574 Product name: Recombinant mouse MIF protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 2-115 aa of NM_010798.2 Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA Predict reactive species Full Name: macrophage migration inhibitory factor Calculated Molecular Weight: 13KD Observed Molecular Weight: 13 kDa GenBank Accession Number: NM_010798.2 Gene Symbol: Mif Gene ID (NCBI): 17319 RRID: AB_3670887 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P34884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924